General Information

  • ID:  hor005548
  • Uniprot ID:  P33439
  • Protein name:  Gonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Clarias gariepinus (North African catfish) (Silurus gariepinus)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Clarias (genus), Clariidae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSHGLNPG
  • Length:  10
  • Propeptide:  MGIKRALWWMVVCVVVLQVSAQHWSHGLNPGGKRAVMQESAEEIPRSSGYLCDYVAVSPGNKPFRLKDLLTPVAGREIEE
  • Signal peptide:  MGIKRALWWMVVCVVVLQVSA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P33439-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005548_AF2.pdbhor005548_ESM.pdb

Physical Information

Mass: 129292 Formula: C50H69N17O14
Absent amino acids: ACDEFIKMRTVY Common amino acids: GH
pI: 7.72 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -137 Boman Index: -1577
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: -713 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  1520292
  • Title:  Two gonadotropin-releasing hormones from African catfish (Clarias gariepinus).